SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017794 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017794
Domain Number 1 Region: 38-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000206
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 129-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000384
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017794   Gene: ENSMODG00000014236   Transcript: ENSMODT00000018123
Sequence length 205
Comment pep:known_by_projection chromosome:BROADO5:4:363819924:363846968:1 gene:ENSMODG00000014236 transcript:ENSMODT00000018123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVSNQQFAGGCAKAAEEAATGDAARAGEEPQPLHGAGICKWFNVRMGFGFLSMTARAG
VALDQPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCLGSERR
PKGKTLQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQSPS
SQGKPAYFREEEEIHSPALLPEAQD
Download sequence
Identical sequences F6T943
ENSMODP00000017794 XP_001363469.1.35504 13616.ENSMODP00000017794 ENSMODP00000017794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]