SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017807 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017807
Domain Number 1 Region: 184-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-78
Family Nuclear receptor ligand-binding domain 0.0000000021
Further Details:      
 
Domain Number 2 Region: 132-212
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-30
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017807
Domain Number - Region: 105-145
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0418
Family Hydrophobin II, HfbII 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017807   Gene: ENSMODG00000014249   Transcript: ENSMODT00000018136
Sequence length 462
Comment pep:known_by_projection chromosome:BROADO5:2:270683291:270690889:-1 gene:ENSMODG00000014249 transcript:ENSMODT00000018136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSGRDCRSPDSSSLSSSPQPPPRGGPPSSPPGPPLAPLPSAASSLLGTGGPPQLPLGS
PFPVISSSMGSPGLPPPAPPGPYGPVSSPQINSTVSLPGGGSGPPEDVKPPMLGVRGLHC
PPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDK
RQRNRCQYCRYQKCLATGMKREAVQEERQRGKEKDGEGEGAGGAPEEMPVDRILEAELAV
EQKSDQGVEGPGGAGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVIL
LRAGWNELLIASFSHRSISVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
RMDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLESYCKQKYPEQQGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences F6Y1I2
ENSMODP00000017807 ENSMODP00000017807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]