SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017859 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017859
Domain Number 1 Region: 285-473,787-933
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.71e-116
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000482
Further Details:      
 
Domain Number 2 Region: 6-119
Classification Level Classification E-value
Superfamily DUSP-like 1.31e-37
Family DUSP, domain in ubiquitin-specific proteases 0.000000356
Further Details:      
 
Domain Number 3 Region: 500-602
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.000000209
Family RNA 3'-terminal phosphate cyclase, RPTC 0.024
Further Details:      
 
Domain Number 4 Region: 146-217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000106
Family UBX domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017859   Gene: ENSMODG00000014291   Transcript: ENSMODT00000018188
Sequence length 983
Comment pep:known_by_projection chromosome:BROADO5:8:21827347:21994135:1 gene:ENSMODG00000014291 transcript:ENSMODT00000018188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGAADLDTQQSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQMLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNINNRNVKNSNYCLPSYTTYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYL
VRMDPLTKPMQYKVVVPKIGNILDLCTALSTLSGVPADKMIVTDIYNHRFHRIFAMDENL
NSIMERDDIYVFEITINRTEDTEQVIIPVCLREKYRHTGYSHHSGSSLFGQPFLMAVPRN
NTEEKLYNLLLLRMCRYVKTSTETEETEGSLHYCKDQNINGNGPNGIHEECSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLLMGHKKRLFTFQFNNL
GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPELKKRYFDDNAAEDFEKHESVEYK
PPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFS
YSRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNK
DDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKQGASAATGIP
LESDEDSNENDNDLENENCMHTN
Download sequence
Identical sequences F6WKA0
13616.ENSMODP00000017859 ENSMODP00000017859 XP_001363243.1.35504 ENSMODP00000017859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]