SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017947 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017947
Domain Number 1 Region: 6-230
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.16e-47
Family DnaQ-like 3'-5' exonuclease 0.000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017947   Gene: ENSMODG00000014359   Transcript: ENSMODT00000018277
Sequence length 231
Comment pep:known_by_projection chromosome:BROADO5:6:194265435:194266127:1 gene:ENSMODG00000014359 transcript:ENSMODT00000018277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSRPMETLVFMDLEATGLPFSQPKVTELCLVAIHRHALEASQQAPPPGGASSVPPTPRV
ADKLCLCVAPGKACSAAASSLTGLNTAMLTAHRRGPFDSALADLLQAFLRRQRPPLCLVA
HNGDRFDFPLLQAELSAAGLGTDALSGAFCADSITALRALDRSGPPIESSQRKSYSLGNV
YARLFGQAAPDTHTAEGDVLALVSVCQARPRPLLQWIDTNARPFSSVRPMY
Download sequence
Identical sequences F6U4Q1
ENSMODP00000017947 13616.ENSMODP00000017947 ENSMODP00000017947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]