SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018023 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018023
Domain Number - Region: 11-58
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0225
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018023   Gene: ENSMODG00000014417   Transcript: ENSMODT00000018355
Sequence length 532
Comment pep:known_by_projection chromosome:BROADO5:4:364423814:364437739:-1 gene:ENSMODG00000014417 transcript:ENSMODT00000018355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSAAEVADEIVSPVYLVVSGIPSGLRSAQLRNYFSQFREQRGSGDSGFLCFHYRHRP
ERALAPEPAATPIPVPQSPSGAAVPSNPPSVAPARSPSPTPASPATCCCVISVRGPAQAQ
RLLRMYSGRQWLDSQGNWLPGRCRIRRLRLPVQEAGVDPFPFKTRKELHRKKALSEAFTL
TDLRQLPELNPPALMPNGNVGTPMHIFLELIRTCRLPPRIITQLQLQFPKTGSSRRYGNV
PFEYEDSEIIEQEELVYTAQGEEIPETPRGAFPTTIPTGIQEELKEDKEEESHSDDDNDT
CEEWERHEALHEDVTGQERTSERLFEEEIELKWEKGGSGLVFYTDAQYWQEEEGDFDEQT
ADDWDVDMSIYYDRDCGDKDARDSVQMRLERRLRDGLEDGSVVSHHVGTFERHTKGIGRK
VMERQGWAEGQGLGSSCSGVAEALDNDGQNPRCKRGLGYHGEKLQSFGQPKRPRGTSLGL
ISTIYDEPLVQDQGDLLLRRQPPTSLKFRADMAFVRGTDTDSFSCQNSPEPE
Download sequence
Identical sequences F7BH84
13616.ENSMODP00000018023 XP_007491442.1.35504 ENSMODP00000018023 ENSMODP00000018023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]