SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018106 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018106
Domain Number 1 Region: 17-272,756-834
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-97
Family Protein kinases, catalytic subunit 0.0000103
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018106
Domain Number - Region: 286-333
Classification Level Classification E-value
Superfamily UBA-like 0.0397
Family UBA domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018106   Gene: ENSMODG00000014489   Transcript: ENSMODT00000018438
Sequence length 920
Comment pep:known_by_projection chromosome:BROADO5:4:241602305:241764251:-1 gene:ENSMODG00000014489 transcript:ENSMODT00000018438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVN
LEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLSESEAR
RKFWQILSAVDYCHSRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGEPLATWCGSP
PYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFM
SEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLVEVPIQRPVLYPQEQENEPSLGEYNEQV
LRLMHSLGIDQQKTMESLQNKSYNHFAAIYYLLVERLKSHRSSFPVDQRVDARQRRPSTV
AEQTVAKAQTVGPPMAIRSPNMRLMRSPILPQTSNVEVFSFPNSGCQADAAFMEEERVDT
PKVNGCLLDPVPPIMVRKGCQSLPSNMMETSIDEGIETEGESEEDPSHSFDAFQSTRCGQ
RRHTLAEVTNQLVMMPGTGKVFSVNDHPSLGSVDSEYDMGSIQRDLNFLEDNPSLKDIML
ANQPTHRLTPPFISIRPANPAMQVLSSQKRETHNRSPVSFREGRRASDTSLTQGLVAFRQ
HLQNLARTKGILELNKVQLLYEQMGSEAEPSLASAAPQLQDLVSSASQEEATQQQENASA
FPNTVHPQLSRRQSLETQYLQHRLQKPNLLSKAQNTCQLYCKESPRSLEQQLQEHRLHQK
RLFLQKQSQLQAYFNQMQIAESSYPRPNQQLPLPHQEQLSSPQAQSPQPPQFSLAQSLSP
VLEPSSEQMQYDPFLSQYRKLQLQPLPSSQVPGSPPPLPSQLQQQPPQPPAAPPPLPFSY
QTRELPGAAPPEPDYPAPCQYSMDPAQQSNVALPDCPRSSGPRESPSSYDPLALSELPGL
FDCEMVEAVDPQPSGYVLVN
Download sequence
Identical sequences F7FKT7
XP_001371323.1.35504 ENSMODP00000018106 ENSMODP00000018106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]