SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018108 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018108
Domain Number 1 Region: 140-283
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.13e-44
Family Ribonuclease H 0.00032
Further Details:      
 
Domain Number 2 Region: 30-74
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000000000000277
Family N-terminal domain of RNase HI 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018108   Gene: ENSMODG00000014491   Transcript: ENSMODT00000018440
Sequence length 286
Comment pep:novel chromosome:BROADO5:1:539533217:539569083:1 gene:ENSMODG00000014491 transcript:ENSMODT00000018440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAMLKLWAFVPEIAAGACGRWGVRFLSSGMFYAVRRGRQTGVFLTWSECQAQVNRFPAAR
FKKFATEDEAWAFVRNATSPDRSTEQKKKCGTQDPKFKPNKRPRESSDEDEEPCSKLAKQ
AMDTVPSLSKDIFSYMGDAAVVYTDGCCSSNGRRKARAGIGVYWGPGHPLNVADRLLGRQ
TNQRAEIHAACKAIEQAKNQNINKLVLYTDSMFTINGITSWIKDWKKNGWKTSTGKEVIN
KEDFVKLDTLTQGIDIKWIHVPGHSGFAGNEEADRLAREGAKKSQE
Download sequence
Identical sequences F7FKT3
ENSMODP00000018108 13616.ENSMODP00000018108 ENSMODP00000018108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]