SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018175 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018175
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-44
Family Third domain of FERM 0.000000185
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-39
Family Second domain of FERM 0.000000643
Further Details:      
 
Domain Number 3 Region: 495-581
Classification Level Classification E-value
Superfamily Moesin tail domain 6.8e-33
Family Moesin tail domain 0.0000226
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.85e-26
Family First domain of FERM 0.0000064
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018175
Domain Number - Region: 430-476
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00275
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018175   Gene: ENSMODG00000014549   Transcript: ENSMODT00000018507
Sequence length 598
Comment pep:known_by_projection chromosome:BROADO5:4:243422228:243510393:1 gene:ENSMODG00000014549 transcript:ENSMODT00000018507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVRKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQSKYGDHNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFAIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMK
AQKELEEQTRRALELDQERKRAKEEAERLEKERRAAEEAKAALAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKRKRREASEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPP
TENEHDEHDENNAEASAELSNDGVLNHRSEEERVTETQKNERVKKQLQALSSELAQARDE
TKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAIYTEEEKASCVVEKALW
Download sequence
Identical sequences F7E8X5
ENSMODP00000018175 XP_016289356.1.35504 ENSMODP00000018175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]