SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018180 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018180
Domain Number - Region: 384-407
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00942
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018180   Gene: ENSMODG00000014555   Transcript: ENSMODT00000018512
Sequence length 856
Comment pep:known_by_projection chromosome:BROADO5:4:243554630:243637768:-1 gene:ENSMODG00000014555 transcript:ENSMODT00000018512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLKDHLGHDLGHLYVESTDTHISAIVPWSMVEKPTMDKVNSRKEDMEKVVSEETGSSSC
DSEENTNSDNESEQLGSIAVEPCLFTKTHRQLCRSPCLEPHIFKCNEILQELKTEEKQST
HKEVKKPPDVVKEYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEN
DPTVSTINSSINRETSSLESQRSDSPLPEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSC
RGIKLAVDWFLERGHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQ
GRRVVCYDDRFIVKLAFESDGIIVSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPP
DDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGKKCTYGHKCKYYHPERGSQPQRSVADEL
RAMSRNTAAKTANEGGLVKSNSVPCSTKTDSPADVKRATPKRQSDPSIRTQVYQDLEEKL
PTKNKLETRSVPSLVSIPPSSAAKPQSTTPLSNGLPSGVHFPPQDQRPQGQYPPMMMATK
NHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSVSGPRSPERRFSLDTDYRISSVASDCS
SEGSMSCGSSDSYMGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNSQPFLQSFHDPLTRV
QSYSHEEPKHHHKPPIPYMAVHLQHPAVGARSSCPGDYPSPQNSAHSKTLHLGRSLVSTR
IDSISDSRLYDNSPSRQRKPYSRQEGLGSWERQNYGIDAYGYRQTYSLPDNTTQPCYEPF
TFQSLPEQQDQTWRVPFCGLPQDAPRYQDNREKVYINLCNIFPSDLVRVVMKRNPHMTDA
QQLAAAILVEKSQLGY
Download sequence
Identical sequences F7E8N8
XP_007494931.1.35504 XP_007494932.1.35504 XP_007494933.1.35504 XP_007494934.1.35504 XP_016289357.1.35504 ENSMODP00000018180 ENSMODP00000018180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]