SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018275 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018275
Domain Number 1 Region: 214-312
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-26
Family C1 set domains (antibody constant domain-like) 0.00016
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily Immunoglobulin 7.03e-21
Family C1 set domains (antibody constant domain-like) 0.004
Further Details:      
 
Domain Number 3 Region: 110-208
Classification Level Classification E-value
Superfamily Immunoglobulin 8.01e-18
Family C1 set domains (antibody constant domain-like) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018275   Gene: ENSMODG00000014627   Transcript: ENSMODT00000018608
Sequence length 319
Comment pep:known chromosome:BROADO5:1:297352689:297362232:-1 gene:ENSMODG00000014627 transcript:ENSMODT00000018608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKTSPTVFPMSLCDSRTGDSVALGCLAQGFFPEPVTLSWNYNGSEGTVRSYPAMLSGNT
YLQTSVLDLPANQCPEAYKCRAEHYNTSVDANVPCPVPPRPCDCPSGVHVSLSGPSLESL
LLGIGANLTCTLSGIKNSNGATFTWVHDTAQASTLRPIQGAPEQDSNGKYRVSSVLEICT
EEWLRGDTFSCTVSHSEIETTTKTIYKPKVPQIPPQIYLLTPSADEQALNEMVSITCLVR
GFSPEDIFIRWLKGSEELPKKDYITSNPYPEPKSTSTYMVSSILQVQSTDWKNENKYSCV
VGHEALPLNFTQQTIDRLS
Download sequence
Identical sequences F6YPT2
ENSMODP00000018275 ENSMODP00000018275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]