SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018281 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018281
Domain Number 1 Region: 280-404
Classification Level Classification E-value
Superfamily TRAF domain-like 4.91e-24
Family MATH domain 0.0036
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000303
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 90-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000778
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018281   Gene: ENSMODG00000014632   Transcript: ENSMODT00000018614
Sequence length 1003
Comment pep:known_by_projection chromosome:BROADO5:2:173113201:173247073:1 gene:ENSMODG00000014632 transcript:ENSMODT00000018614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRSAKDERVR
EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPAYDSTTFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSSNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNRQNDTVILRFQVRSPTFFQKCRDQHWYIT
QLETAQTSYIQQINNLKERLTIELSRSQKSRGMSPPDTHLSPQNSDGLEMRANKKTGSSC
ELLLEGVPAAASVREAKDDEDEEKNQHEDYNHELSDGDLDIDLVGEDEVNHLDGSSSSAS
STATSNTEENDIDEETMSGENDVEYSNNMELEEGELVEDTTAAGASGSSHGYTSASRRAS
RRAGNTGSAASSSLLDIDPLILIHLLDLKDRSSMESLWGLQPRPPASLLQSTASYARKDK
DQRRQQAMWRVPPDLKMLKRLKTQMAEVRSKMSDVKNQLSEVRSNNAGSCDVQSNSFSAD
QSLAACPTESCGKLQDLGMELLTKSAVTSCYIRNSTNKKSNSPKPTRSGTAGSLSLRRAV
DCGDNNHRPKADCQTSTEGCPGTSQSGSRHSPPRALTHGNICEVLPKTEDRQCEVLDPDV
LIVSGLNGLPAMEKTRKMVTLGSNAKGCRIEGTPITDMENNSETGELQAILPEGASAVPE
EAVLCQKHVLRLLPGMSSDSDVECDTENEEQEENAPLDVFNDSFMVQPTGQDSCSSFPEG
DQIGPEDLSFSTGDNSGREFIAEKCHERENTACLSPKSTQCKS
Download sequence
Identical sequences F6YPE7
ENSMODP00000018281 ENSMODP00000018281 XP_007481861.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]