SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018359 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018359
Domain Number 1 Region: 30-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.22e-47
Family Eukaryotic proteases 0.00000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018359   Gene: ENSMODG00000014688   Transcript: ENSMODT00000018692
Sequence length 269
Comment pep:novel chromosome:BROADO5:1:706989483:706994705:-1 gene:ENSMODG00000014688 transcript:ENSMODT00000018692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQHPEVPSCPNHPDFSSGCGVTAIKPVVSGLARIVSGEVIPGSWPWQVSLQRKSLDPDKN
GWHFCDKSIISQDWVVNAAHCGVTSNCFKFPGNYGEKMVETKKTALLVMGLWKQGGFSRI
PISIPSTSSTSLIKLATPLHFSDTVSTFCLPSSTDDFPAGSTSVATGWGLSDDNNSIIPK
KLQQAALPLISNTQCNKFWWVKDVMICAGTSGVSTGMDDSGGPLVYQKDGAWNLVGIVSG
GSGTCSTSPGVYAHVTKLMPLVQEILAAN
Download sequence
Identical sequences F7DNK8
13616.ENSMODP00000018359 ENSMODP00000018359 ENSMODP00000018359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]