SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018391 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018391
Domain Number 1 Region: 270-319
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-18
Family RING finger domain, C3HC4 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018391   Gene: ENSMODG00000014712   Transcript: ENSMODT00000018724
Sequence length 778
Comment pep:known_by_projection chromosome:BROADO5:2:174003110:174106315:1 gene:ENSMODG00000014712 transcript:ENSMODT00000018724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGHQLQLAALWPWLLMATLQAGLGHTGLVLAAAVESERSAEQKAVIRVIPLKMDPTGR
LNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCL
SLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLRWPVVLIWDKDAEKLMEFVYKNQ
KAHVRIELKEPPAWPDYDVWILLTVVGTIFVVILASVLRIRCRPRRRPEPLQQRTAWAIS
QLATRRYRTSCRLFQSQWSDSGSNYSSAPICAICLEEFTDGQELRVISCRHEFHRTCVDP
WLYQHQTCPLCMFNIIEGTPFLQSSGPSHPYQEPGRRLHLIRQHPGHAHYHLPEAYLQGT
LQTPVAQPPQPGPFLSSMEHGSWHHHPSRTLHLGHACTRPRPGALHNPHTASWRLGRFRA
CSMQHPLTCSTSPRRSRPHDSSGSGESYRTERSGYLADGPASDSSSGPCHGSSSDSVVNC
TDISLQGIHGSSSTFRSSLSDFDPLVYCSPESETQEEVQLSIGYRPRSLDSVIPKTDPQV
SSHIHYHKHRHHHYNKRFQWHGRKARPETGLSQLRLTASQTEPQSEPPPLVQKTPKSIAS
SPSTQVSYPRPRALTESNCGSEENSDPSPACLPSPLGLQRPVVLTHHPQRKQRGLPEPIS
VLQPQDVPVISNCKVCPNHDPNLTCPWPRETHPLIPGPLGLDTRLLPDATGPCYSSSQPV
WLCLTKCHPLSHRPPEERSTEWSADVLEDRSCPYPHCQVLTAQPGPEEEIEELCEQAV
Download sequence
Identical sequences F7D310
ENSMODP00000018391 13616.ENSMODP00000018391 XP_001362952.1.35504 ENSMODP00000018391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]