SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018402 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018402
Domain Number 1 Region: 139-343
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 8.24e-40
Family AlkB-like 0.0025
Further Details:      
 
Domain Number 2 Region: 367-518
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.56e-27
Family CAC2371-like 0.057
Further Details:      
 
Domain Number 3 Region: 32-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.39e-17
Family Canonical RBD 0.0000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018402   Gene: ENSMODG00000014721   Transcript: ENSMODT00000018735
Sequence length 668
Comment pep:known_by_projection chromosome:BROADO5:4:246789124:246845450:1 gene:ENSMODG00000014721 transcript:ENSMODT00000018735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSASIENYQSHSKLSKTEKKFLRKQTKARHTLLRHEGIESVSHATESLVIANGGLGN
GVSRTQLLNIFERYGSVEALLMPPNKPYSFVRYRTKEESQKAYVALNGKEMVDDLGQNIT
LYLNFVEKVHWGDLRPSVLPPGLMIMEEIVSPEVEKILLESIDWTHNLVDENAQKSLKHR
KVKHYGYEFRYDNNNVDKDKPLPGGLPDICNSILEKWLTEGHIKYIPDQLTINQYEPGQG
IPPHIDTHSAFEDEIISLSLGAEIVMDFKHPDGHTVSVMLPQRSLLVMTGESRYLWTHGI
TPRKFDVIQASEGQKSGIITNDVGNLTLNKRGVRTSFTFRKVRRTPCDCSYHLVCDSQRC
HQNETLPSFPENDKKASELEREYVHRVYEEIAEHFSSTRHTPWPQIVAFLKALPKGSVVA
DIGCGNGKYLGLSKDIYMVGCDRSQNLVEICGERQFEAFVCDALAVPIRSETCDACISIA
VIHHFATAERRLATLQELARLLRPGGKALIYVWAMEQEYNKQKSKYLRESRDTKEKKEHL
NSVVIPGTSSHNSVCSIPAINDLKDGDYNTNGVSNSKLPVHTNRTSFHSQDVLVPWHLKK
DSRRDKGSEPLKPIPDLVGPHDPSTVFHRYYHVFCEGELEAACRMVNNISIEQSYYDQGN
WCVIFKKL
Download sequence
Identical sequences F6ZD81
XP_007494955.1.35504 ENSMODP00000018402 ENSMODP00000018402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]