SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018415 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018415
Domain Number 1 Region: 17-120
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-22
Family Canonical RBD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018415   Gene: ENSMODG00000014730   Transcript: ENSMODT00000018748
Sequence length 297
Comment pep:novel chromosome:BROADO5:8:276639167:276657634:-1 gene:ENSMODG00000014730 transcript:ENSMODT00000018748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAANPETPNSTISREASTQSSSATASQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFF
ARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLC
AYHVQPRPLVFNPPPAPQFHSVWSNPNTETYMQPPAMMNPITQYVQAYPPYPNSPVQLIT
GYQLPIYNYQVPPQWPAGEQRSYVIPPAYTAVNYHCSEVDPGAEVLQTECSVHEVTHHTL
LTDSVFQKSVDRSIQTVVSCLFNPETRLRNALVTQDDYFKDKRVHHFRRSRAVLKSV
Download sequence
Identical sequences F6ZCR3
ENSMODP00000018415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]