SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018429 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018429
Domain Number 1 Region: 288-504
Classification Level Classification E-value
Superfamily LigT-like 4.18e-96
Family 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain 0.000000028
Further Details:      
 
Domain Number 2 Region: 159-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000133
Family Nucleotide and nucleoside kinases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018429   Gene: ENSMODG00000014742   Transcript: ENSMODT00000018762
Sequence length 526
Comment pep:known_by_projection chromosome:BROADO5:2:194490967:194499349:-1 gene:ENSMODG00000014742 transcript:ENSMODT00000018762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSLGGWVGLTFDSWGELVEGACAQAREEPGRVTCLEATWLRLLTLDCKTSQDWGGGGLL
DSLCSRAAGRALVEAELRLPQHGDDGLSFLRFPVALCRDCSVALLTSSLNRGFSRKSHTF
LPKIFFRKMSSSAAKDKPELQFPFLTDEGTVNTLRECKTLFVLRGLPGSGKSTVARAIEE
RYRDGTKIVSADTYKITPGSRAAFQEQYKQLDEDLDNYCRRAISILVLDDTHHERDRLEK
IFEVADQYQYMVVLVEPKTSWRLDCALLKEKNQWQLSADDLKKLKPGVEKDLLPLYFGWF
LSKKSSESLKKAGLAFLDELSNHKAFKKEIQHFVSGDELKEKIALASYFVRRPPVLHCTT
KFCDYGKADGANEYAQLEVVKKSYSKAFTLTVSELFVTPKTTGARVELSEQELPLWPTDV
DKLTADSLPRGSRAHITLGCAAGIEPVQTGIDLLEMLRQEKGGSQGEEVSELNRGKLYSL
GNGQWKLRLIKKLELRAVFSGYYGKGQTVPTHSSRKGGALPSCTII
Download sequence
Identical sequences F6ZC06
XP_016285952.1.35504 ENSMODP00000018429 ENSMODP00000018429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]