SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018486 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018486
Domain Number 1 Region: 15-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.74e-36
Family Canonical RBD 0.00000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018486   Gene: ENSMODG00000014781   Transcript: ENSMODT00000018819
Sequence length 292
Comment pep:known_by_projection chromosome:BROADO5:2:174829236:174831349:1 gene:ENSMODG00000014781 transcript:ENSMODT00000018819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGGAPRGRYGPPSRRS
EYRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTK
FRSHEFCLFNREKLPTSVLKLMGQEVQVMEDLGLEAVVVAEAVVEATAGVAVIPQEEAED
LHATPPVIVDLALVHKIIGDTFCRTHVVYSFPLLSTIFHFFFNSNCFIQNGL
Download sequence
Identical sequences F7G6X8
13616.ENSMODP00000018486 ENSMODP00000018486 ENSMODP00000018486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]