SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018489 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018489
Domain Number 1 Region: 33-87
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000122
Family CUE domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018489   Gene: ENSMODG00000014783   Transcript: ENSMODT00000018822
Sequence length 376
Comment pep:known_by_projection chromosome:BROADO5:2:174926034:175010861:1 gene:ENSMODG00000014783 transcript:ENSMODT00000018822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSNGGSRGGGNASAQELNNSRPARQVRRLEFNQAMEDFKTMFPNMDYDIIEC
VLRANNGAVDATIDQLLQMNLDGSSYDDSSDSDDSIPPEILERTLEPDSSDEEPPPVYSP
PAYHMHMFDRPYPLAPPTPPPRIDVPSAGVPPTQRRYRNWNPPLLGNLPDDFLRILPQQL
DSLQNAQSGPPKPGLGEASQPLAGNLEEECRWKQYLEDERIALFLQNEEFMKELQRNRDF
LLALERDRLKYESQKSKSSSMAVSNDFGFPSTVTGDAALGASEANPAVSEDALFRDKLKH
MGKSTRRKLFELARAFSEKTKMRKTKRKQLLKHQSLGTAASTANLLDDMEGHACDEDFRA
RKQEPLKEEEAPREGQ
Download sequence
Identical sequences F7G6X0
ENSMODP00000018489 XP_007481894.1.35504 XP_016285815.1.35504 XP_016285816.1.35504 XP_016285817.1.35504 XP_016285818.1.35504 ENSMODP00000018489 13616.ENSMODP00000018489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]