SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018496 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018496
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000285
Family Canonical RBD 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018496   Gene: ENSMODG00000014790   Transcript: ENSMODT00000018829
Sequence length 207
Comment pep:known_by_projection chromosome:BROADO5:2:175142850:175788792:-1 gene:ENSMODG00000014790 transcript:ENSMODT00000018829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGR
ARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYSYQFPGFPAAAYGPVAAAAVAA
ARGSVLNSYSAQPNFGAPASPAGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIGA
ASPQPGSGFSHGIAGPLIATAFTNGYH
Download sequence
Identical sequences F7G6R7
ENSMODP00000018496 ENSMODP00000018496 13616.ENSMODP00000018496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]