SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018583 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018583
Domain Number 1 Region: 359-612
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.49e-109
Family STAT DNA-binding domain 0.000000000166
Further Details:      
 
Domain Number 2 Region: 170-358
Classification Level Classification E-value
Superfamily STAT 2.16e-61
Family STAT 0.0000000107
Further Details:      
 
Domain Number 3 Region: 613-751
Classification Level Classification E-value
Superfamily SH2 domain 8.08e-44
Family SH2 domain 0.0000000932
Further Details:      
 
Domain Number 4 Region: 35-154
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.14e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018583   Gene: ENSMODG00000028212   Transcript: ENSMODT00000018917
Sequence length 808
Comment pep:known_by_projection chromosome:BROADO5:2:194024737:194108052:1 gene:ENSMODG00000028212 transcript:ENSMODT00000018917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWIPLPLIQPTWLLLQLQSMKPWLQLTTLLSSKMAQWNQLQQLDTRYLEQLHQLYSDSF
PMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRI
KQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQ
HLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKIRFSSTDMQDLNGNNQSVTRQKMQQL
EQMLTALDQMRRGIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRL
ENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVV
ERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRK
FNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFET
EVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQ
VAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWV
WLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGITFTW
VEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAF
GKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEG
AEPSSGGGQFETLTFDMDLTSECAASPM
Download sequence
Identical sequences F7BYN4
ENSMODP00000018586 ENSMODP00000018583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]