SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018625 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018625
Domain Number 1 Region: 31-126
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-29
Family SH2 domain 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018625   Gene: ENSMODG00000014894   Transcript: ENSMODT00000018961
Sequence length 322
Comment pep:known_by_projection chromosome:BROADO5:3:479330124:479365365:1 gene:ENSMODG00000014894 transcript:ENSMODT00000018961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKGQMQAPSLSSHLNGFGETRASWLMQDGIPTWYHGAISREAAESLLQEKPPGCFLVRMS
QSHVGYTLSYRSKDRCRHFMIKLLPDGCLAIPGEKGVHATLVELVSFYQKNAIQPFEELL
TQPCGRVNENDVEYDDFSLYSNVAVGGKTSPKPKANTSDSSSQPFDQSPATSHAQKSGKA
LLNNAPQKIWKNLKNLPQTGKKITEQIKSHLLDSSVTQVEESHSEREAQNSPINIYVDPF
EQASHPKHTSHSKIQHLGLSLRKTVGTSTIPISTSEKPILPGPRRRTISSETTSQDSPWS
PSDKLCFLPEEYQPPPPFAPGY
Download sequence
Identical sequences F7GGA1
ENSMODP00000018625 ENSMODP00000018625 13616.ENSMODP00000018625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]