SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018671 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018671
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-27
Family SH2 domain 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018671   Gene: ENSMODG00000014931   Transcript: ENSMODT00000019008
Sequence length 133
Comment pep:known_by_projection chromosome:BROADO5:X:17785720:17940356:1 gene:ENSMODG00000014931 transcript:ENSMODT00000019008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVSVYHGNISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQSE
TGSWSAETAPGVQKRLFRKIKNLISAFQKPDQGIVIPLQHPVEKKLLQMNKPGLEQELST
TVMSNSSRKEAVE
Download sequence
Identical sequences F7FV71
ENSMODP00000018671 13616.ENSMODP00000018671 ENSMODP00000018671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]