SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018717 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018717
Domain Number 1 Region: 40-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000262
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018717   Gene: ENSMODG00000014969   Transcript: ENSMODT00000019054
Sequence length 1660
Comment pep:known_by_projection chromosome:BROADO5:7:170729152:170831248:-1 gene:ENSMODG00000014969 transcript:ENSMODT00000019054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGNTAETQCRNWLKTGNCPYGNTCRFI
HGPSPRGKGYSSSYRRSPERPTGDLRERMKNKRQDVETEPQKRNTEESSSPVRKESSRGR
HREKEDIKITKERTPESEEENVEWETNRDDSDNGDINYDYVHELSLEMKRQKIQRELMKL
EQENLEKREEIVIKKEISPEVVRSKLSPSPSLRKSSKSPKRKSSPKSSSSASKKDKKITT
VSSPLLDQQRSSKSNQSKKKGPRTPSPPPPIQEETALGKKHKEKHKAKERVEEKPREGKD
RGRDFERHKEKKEKQRDPSEGSHRQKRSPSPADHSGSNSSPSREYSPPAAKRRQASRAPT
KSSTQKHSFSPSRRSASPAGQRHSPLSSRHHSSSSQSGSSVQRHSPSPRRKRTPSPAYQR
TASPPVRRSPSPYPPRSSSSPQRKRSPSRHRSPGREKGRHDHERTSQSHDRRHERREDTR
GKRENREKETREEREYDQDQSSSRDHRDDRESRDGRDRRETRDTRDRRELKESRDVRDSR
DTRDYNRDNKDSRDQRDSRSTRDTHDYRDRESRDTHRKEDTYQEDSRSYGRNHGREESSR
TETRNDSRNESRNESRSDRTGRSRGRGPELPEKGGRGTRGSQVDGHNSGGNYHESWDSRS
GYPERDRYDARDQARDSSFERRHGERDRRDNRERGIKTIFVSLKEFDPRPNSPVRHQGRG
DELERDERREERRIDRTDDRRDERARERERERERERERERERERDREREKERELERDRAR
EREREREREKDRERDRERDRDHDREREREREREREKEREREREERERERERERERERERE
RGREREKERDRQRDWEDKGRDDRREKREDIREDRNPRDVHDERKSKKRHRTESSLSPRQS
PKRRREHSPDSDTYNSGDDKNEKHRLLSQVVRPQESRSLSPSHMAEDRQNRWKEEDRKTE
RKESSRRYEEQELKERVSSGDKQRGEQPEVIESSRTRAQESVGHHQPEERDGSDRTHEEN
KKKYKVQKRTTKRKKDDDIGMERYSTESATEEGQVFSPKKGQKKKNVEKKRKRSKGDSDI
SDDEIVQHSKKKKGPRTPPATTTKEELVEVSNEKNGTTLETSQKREDTTFSDWSDEDVPD
RGDVIVPERSTEESQRKCHKTRVEKIEAPHVTIEDAPHRKPIDQKRSSSLGSNRSNRSHT
SSRLRSPSNDSAHRSGDDLTGRKRVLHSSSRDREKTKSLEIPGERKSRIDQLKRGEPSRS
TSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRERLQERDRHDHDRERERERRETRQRE
WDRDTDKDWPRNRDRLRERERERDKRRDLDRERERQNPDSSERDRDRTLDISSHIESSKR
SETKLDEHEKDFEGICRDSVALEKERLEKDLGPLHGFEDVNEAEKTESLEAGDDEAKLDD
AQSLGSGAGEGYEPISDDELDEILAGDAEKREDQQDDEKMPDPLDVIDVDWSGLMPKHPK
EPREPGAALLKFTPGAVMLRVGISKKLAGSELFSKVKETCQRLLEKPKDAENLFEHELGA
LNMAALLRKEERAGLLSNLGPCCKALCFRRDSAIRKQLVKNEKGTLKQTYTNTPVVDNEL
LRLSLRLFKRKTTCHGPGQEKTEENSKLSQPSIQPEVCVS
Download sequence
Identical sequences F7CGT1
ENSMODP00000018717 XP_007501647.1.35504 XP_007501648.1.35504 ENSMODP00000018717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]