SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018720 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018720
Domain Number 1 Region: 256-344,436-473
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.19e-41
Family Inhibitor of apoptosis (IAP) repeat 0.00000305
Further Details:      
 
Domain Number 2 Region: 128-236
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.62e-34
Family Inhibitor of apoptosis (IAP) repeat 0.0000015
Further Details:      
 
Domain Number 3 Region: 23-113
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.3e-25
Family Inhibitor of apoptosis (IAP) repeat 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018720   Gene: ENSMODG00000014970   Transcript: ENSMODT00000019057
Sequence length 498
Comment pep:novel chromosome:BROADO5:X:17494487:17525908:1 gene:ENSMODG00000014970 transcript:ENSMODT00000019057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFKSFEDSKTCVPPDINKDEDFVEEFNRLKTFANFPSSSPISASTLARAGFLYTGEGDT
VKCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFEKNATRFPNPIIQNCQYRVENC
SRNRNHFALERPSETHGEYLLRTGQVIDMSDTIYPRNPSMCSEEARLRSFQNWPDYAHLT
PQELASAGLYYMGFEDQVQCFCCGGKLKNWEPCDRAMSEHKRHFPKCFFVLGRDVGNTRI
ETDVSCDRSCPNPTHLPRNPAMADYEARLITFATWIYSVNKEQLAKAGFYALGDHDKVLC
FHCGGGLTDWKPNEDPWEQHAKWYPGCKYLLEEKGQEYVSSIHLVHPFNSSMAESRKMAS
SVTQEIDDSVLQNPLVQDAIRMGFNFLEIKKIMREKIQSSGNNYTSLELLVADLVSAQKE
SSQDGESSPTLSEKEISTEEQLRRLQEEKLCKICMDENIAVVFIPCGHLVSCQLCAEAID
KCPMCYTVITFKQKIFMS
Download sequence
Identical sequences F7CGN1
ENSMODP00000018720 ENSMODP00000018720 XP_007507130.1.35504 XP_007507131.1.35504 XP_007507132.1.35504 XP_007507133.1.35504 XP_007507134.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]