SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018736 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018736
Domain Number 1 Region: 92-198
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000143
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 505-568,619-649
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000269
Family Second domain of FERM 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018736
Domain Number - Region: 400-492
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000171
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018736   Gene: ENSMODG00000014981   Transcript: ENSMODT00000019073
Sequence length 778
Comment pep:known_by_projection chromosome:BROADO5:2:193621723:193634007:1 gene:ENSMODG00000014981 transcript:ENSMODT00000019073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLRRDYGDGELGGDADEDEDEETFELRTPGSASCGRGPLEVT
LTQPGRSGPGSDRLQGSEETRSLIPERGPPEEEPDIIVKGWLQREPRVGGARPWLPPRRA
WFVLTRDSLDQFSGSGRGARRLGSLVLTSLCSVSGPERKPKETGLWSVTVSGRKHSVRLC
SSRLAEAARWGAALRGVIAGKAPLETPTQLLLRDIQESGGDSEAVALIYRRNPILRHTSS
ALYAPLLPLPYGVGPPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPESPAPHSPAALRYWQLLCCMSCTFRPGGVVRGHLLGHLERT
ERAFPDTELAEYTRFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACSVAI
DSHTTASEVARELVGRLGLARSRNAFALYEQRGSQERALAGGVLVADVLTRFENLTAEEA
ESPDSGWRLCLRLHGPLHPEGLPPDGHELPFLFEQAHALLLRGRPPPPEDTLRALAALRL
QSLHRDFSPLAPLPRLDRLLPASALTRETPPRPTPRAPPTAALLAGALWSPGLAKRKAGR
ARRGGAVRSGGTVVREGGGTGAAAAVLGGWKQLRGMGQAEAMATYLALAAQCPGFGAARY
DVLELSTETGGGVPQQLCLGVGAKTMSLSRPGETEPIHNVSYGHVVACQLTGPHTLALKV
GDSQLLLQSPQVEEIMHLVNAYLANSTPDRSCNLVTTPDLQITPSLVSQNPGLDDHQV
Download sequence
Identical sequences F7CGD3
ENSMODP00000018736 XP_001365570.1.35504 ENSMODP00000018736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]