SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018795 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018795
Domain Number 1 Region: 549-773
Classification Level Classification E-value
Superfamily SET domain 3.92e-61
Family Histone lysine methyltransferases 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018795
Domain Number - Region: 469-508
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00028
Family Myb/SANT domain 0.022
Further Details:      
 
Domain Number - Region: 138-192
Classification Level Classification E-value
Superfamily CalX-like 0.017
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018795   Gene: ENSMODG00000015033   Transcript: ENSMODT00000019134
Sequence length 783
Comment pep:known_by_projection chromosome:BROADO5:2:193542028:193596551:1 gene:ENSMODG00000015033 transcript:ENSMODT00000019134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKTEDQRGKVACPKLNSKMDIPNSPTSKCITYWKRKVKSEYMRLRQLKRFQANMGAKA
LFVANFAKVQEKTQILNEDWKRLRIQPVQLMKPVSGHPFLKKCTVESNFPGFDSQDMLMR
SLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHG
EEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNNDSSEGKQEDNKEELPVLRKRKRLT
IEGSDNSPQKLSVIFGSGNKKSSKKQFPNDMIFSAISSMFPENGVPDDMKERYRELTEVS
DPNVLPPQCTPNIDGPCAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNK
EIKIEPDPCGLDCFLWLEGAKEYAMLHNPRSKCSGRRRRRHQVVNASSTNTSTSAVAETK
EGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPPQLCVVEAPLEPVEWTGAEESLFRV
FHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTNELMNPSQKKKRKHRLWAAHC
RKIQLKKDNSATQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCK
TQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQLGLKKHLLLAPSDVAG
WGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNK
IRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERET
DVL
Download sequence
Identical sequences F7BXB4
ENSMODP00000018795 ENSMODP00000018795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]