SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018834 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018834
Domain Number 1 Region: 181-281
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.55e-20
Family Canonical RBD 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018834   Gene: ENSMODG00000015063   Transcript: ENSMODT00000019173
Sequence length 324
Comment pep:known_by_projection chromosome:BROADO5:2:268177650:268184585:-1 gene:ENSMODG00000015063 transcript:ENSMODT00000019173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLPPGLSEEEEALQKKFSKLKKKKKALLALKKQSNSSTASQGGVKRSLSEQPVVDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPAPTFQPFQRSISADDDL
QESSRRPQRKSLYESFVSSSDRLRELGPDGEESEGPGGGDGPPRSFDWGFEERSGPPSSA
SPPRSRKGPFRRSDSFPEYRGPRKGNTLYVSGTDMTPTLLRGAFSPFGNIIDISMDPPRN
CAFVTYEKMESADQAIAELNGTKVESVQLKVSIARKQPMLDAATGNSVWGSLAVQSSPKG
CHRDKRTQIVYNDDVYKENLVDGF
Download sequence
Identical sequences F7FHL8
13616.ENSMODP00000018834 ENSMODP00000018834 ENSMODP00000018834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]