SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018921 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018921
Domain Number 1 Region: 81-318
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-56
Family DBL homology domain (DH-domain) 0.0000411
Further Details:      
 
Domain Number 2 Region: 316-442
Classification Level Classification E-value
Superfamily PH domain-like 2e-34
Family Pleckstrin-homology domain (PH domain) 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018921   Gene: ENSMODG00000015139   Transcript: ENSMODT00000019263
Sequence length 1025
Comment pep:novel chromosome:BROADO5:3:463754275:463790405:1 gene:ENSMODG00000015139 transcript:ENSMODT00000019263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTISTRGRLQSAMNTPGTLNRFGSGTGEMDESDSGFLKFKQTTDDSLSLASSTTESIFVE
DSYSASLRSEIEADAQEFEAESWSLSVEPAYAKKQKREVLKRQDVIYELMQTEVHHVRTL
KIMLKVYSRALKEEMQFSSRVLNRIFPCVDDLLEMHGQFLYRLKERRRESLAEGSDQNYV
IQKIGDLLVQQFSGENGERMKEKYGIFCSGHNEAVSHYKELLSQNKKFQNMIKKIGNFSI
VRRLGVQECILLVTQRITKYPVLEERIIQNTEAGTEDYEDLNQALGLIKDIITQVDAKVN
ECEKGQRLKEIVGKMDLKSSGKLKNGLTFRKEDMLHRQLHLDGMLCWKTASGRLKDVLAV
LLTDVLLLLQEKDQKYVFASVDSKPPVISLQKLIVREVANEEKAMFLISASLKGPEMYEI
YTCSKDERNSWMAQIRRAVESCPDGEEEPFSEAEEDRKMAEARAVKLKEFQERLSRKDEL
IAQSLIEKQQIYLEMSEMNSFEDLPPGPRPRFFFRGGEPSENLQGEMILKSAVSEIENIQ
NLIYKQLGTVSCRNEDGGSGGGDDLLLPRRAETFGGYDNNANTNKNASFKKKVSNSDTWF
KDRRNPFTSSDSQLGDLSGDSEEGSQILSFQTEGTRVDWNNSLSSILESELIQRIQMLSQ
LLLNLQAVVAQQDSYIEMQRAMILEKEKQYRLQSTRGNFLLEQEKQRNFEKQREELANVQ
KLQNQLKQEQQRWERERERQQKELEYTEARLQERENESQQFKERLTQDKEELDRQREAYQ
HDLERLRESQRAVEKEKDRIEHLKKLKKQNTVSGTLPPEGIEGHILSTSLNFNGEGLEGA
GHLAKTLGRTSTLLSGSDYVERPEMARRDSTTAEGRPVKNDVPIQLLSATNQIQKQAAVQ
QQIPTKLAVFTKGSKEKGGKGKGSQRSDSSTSFDLKQQLMLNKIMGKEENTIRNRRSLSP
VLTSQNVIIHPESCIPADIQPSEISHLNLGNMFRPNSTPILSPPAQLPVHLTSEEDANKE
DVIFF
Download sequence
Identical sequences F7CZN8
ENSMODP00000018921 ENSMODP00000018921 XP_007489633.1.35504 XP_016287793.1.35504 XP_016287794.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]