SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018934 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018934
Domain Number 1 Region: 114-203
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.73e-25
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 2 Region: 330-423
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-21
Family Canonical RBD 0.00000933
Further Details:      
 
Domain Number 3 Region: 4-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-19
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 4 Region: 485-591
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000806
Family Canonical RBD 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018934   Gene: ENSMODG00000015151   Transcript: ENSMODT00000019276
Sequence length 761
Comment pep:known_by_projection chromosome:BROADO5:8:188214501:188258934:-1 gene:ENSMODG00000015151 transcript:ENSMODT00000019276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLTLFVGRLPASASTPQLERLFSQVGPVKQCFVVTEKGSKTCRGFGYVTFSMLEDAQR
AIKEVTTFEGCKINVTVAKRKLKNKMKEKEKKECSDTPQEEPEPKPKPKKTKVADKKARL
IIRNLSFKCSEDDLKTLFAQFGAVLEVNIPRKPDGKMRGFAFVQFKNLLEAGKALKGTNM
KEIKGRTVAVDWAVAKDKYNATQSSTSDEEQKVTECRQQDSRQEEGNEKENKDADDEEED
EDDEDEEENEEESDDDEELQVTKPAKAQKRASKRPLTLDAESSEEDEDSDQEEKGSSEDE
EEPNQNEVDSGEEDQDEEEVPKKKKKRKLPSDVNEGKTVFIRNLSFDSEEEDLGEILQQF
GDLKYVRIVLHQDTEHSKGCAFAQFMTQEAAQACLAAASAETEDGGLKLDGRKLKVDLAV
TRDEAEKLRSKNVKKQTGTRNLYLAREGLIRAGTKAAEGLSAADIAKRERFELLKHQKLK
DQNIFVSKTRLCLHNLPKAVDDKQLRKLLLTATGGGRAVRLKECRVMRDLKGAHGNVKGQ
SLGYAFVEFEEHEHALAALRHINNNPDIFGPQKRPIVEFSLEDGRKLKMKEMRAQRNLQK
MKSKPVADEPPKDQQQQPGKFQKHKASHSHTQGPGKLPLKPKGTIPGSWAGFQTKAEVEH
VELPDGKKRRKVLMLPSHRGPKIRMRDKGKAKPPPPKKPKVQMRHQKQEKRCSVSLQVPK
KKAKGNKSEIRFNQLVEQYKQKILGPTKGAPFGKKSKWFDT
Download sequence
Identical sequences F7CFR9
ENSMODP00000018934 XP_001371879.1.35504 ENSMODP00000018934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]