SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018942 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018942
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.92e-22
Family PB1 domain 0.00000981
Further Details:      
 
Domain Number 2 Region: 216-263
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000004
Family ZZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 963-1001
Classification Level Classification E-value
Superfamily UBA-like 0.00000000598
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018942   Gene: ENSMODG00000015157   Transcript: ENSMODT00000019284
Sequence length 1012
Comment pep:known_by_projection chromosome:BROADO5:2:193045775:193068521:-1 gene:ENSMODG00000015157 transcript:ENSMODT00000019284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQVNLNVTFKNETQSFLVSDSENTTWADVEAMVKVSYDLNTIQIKYLDEDSEEVSINS
QGEYEEALKIAVKQGNQLQMNVYDRHNVVDETPQPGHKELPGTEKRPAVRTGKKPLTHYS
SLVRALGSEMKTQEESTAQLPLTPCEADKPQDKPPDWFTRYLEMFREQVVKETVEKLDQK
LSEKLVLQSPSLESCSSIPVSEEALSLPGNQCDWLMTCSNCQRRIIGIRYQCSLCPSYNI
CELCEAGSYAHDPNHILLKLRRPIMGSSETYTQTKLSPPRLPAALEQVRLQKQMDKNFLK
AEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLHSSTLML
PMQPCAPVVPTLSAAFVDENVPDGTHLQPGTKFIKHWRMKNTGNVKWSAETKLKFMWGNL
TLASTERKDVLVPYLKAGHVGIVSVEFIAPALEGTYTSHWRLSHKGEQFGPRVWCSIIVD
PFPTREHLEDGEKVSFSTNKVDDLSCQQEEAFSLTKEKIQIDEVTESTEGTEPCIPLKIK
SVPSERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDSPLI
EKPGLGQIEEESEGTGFKVLPDTTVASKNKAENTVPAEEGEEDLSGTQFVCETVIRSLTL
DAAPDHNPPRRLKSLQNSLHMLSDNFSYGVRNEETLRTQFSPSSEGESQPQLTEERQPAQ
LDGFSKEKTSLNSILPEERLMNDEKRDTVQVVEEEEEEEEEELKDEVRSQGSSASSEDYI
IILPECFDTSRPLGESMYSSALSQPGLERLTELEQVVKAEQEPAEAYERLARGENQQQGH
LINDILTTSQTLDAVLLTPEVVGPPRQMPSPSSLQNISSEESDLPITIQEFSPVPDQVRG
EPRASSGLVNSRQKSYENSRYYQGSSITGGLVKGAMSFAASAYKALFAGPPVTAQPIVSE
DQTAPLMAHLFEMGFCDRQLNLRLLKKHNLNILQVVTELLQINNNDWYTHRY
Download sequence
Identical sequences F7CF87
ENSMODP00000018942 ENSMODP00000018942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]