SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018959 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018959
Domain Number 1 Region: 469-502,570-622,652-1118
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.23e-88
Family DNA polymerase I 0.00033
Further Details:      
 
Domain Number 2 Region: 36-130,172-450
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.51e-80
Family DnaQ-like 3'-5' exonuclease 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018959   Gene: ENSMODG00000015171   Transcript: ENSMODT00000019301
Sequence length 2242
Comment pep:known_by_projection chromosome:BROADO5:3:463910354:463991955:-1 gene:ENSMODG00000015171 transcript:ENSMODT00000019301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDARFGFERLREPDEKTGWLINMHPTEILDEDKRLVSAVDYYFIQDDGNRFKVALPYKPY
FYIATRKGCEREVSSFLSKKFQGKIAKLETVPKEDLDLSNHLVGLKRNYIKLSFNTVDDL
VKVRKEISPAVKKNRERDNTSDTYTAMLSSALMGVSVTTDEGVSKKIADQLDNVVDMREY
DVPYHIRLSIDLKIHVAHWYNVRYRGSTLPIEITRRDDLVERPDPVVLAFDIETTKLPLK
FPDAETDQIMMISYMVDGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLI
QRWFEHVQETKPTIMVTYNGDFFDWPFVEARAAVHGLSMHQEIGFQKDSQGEYKSSQCIH
MDCLRWVKRDSYLPVGSHNLKAAAKAKLGYDPVELDPEDMCRMATEEPQTLATYSVSDAV
ATYYMYMKYVHPFIFALCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIVFPNKQEQEF
NKLTEDGHVLDSETYVGGHVEALESGVFRSDIPCRFKMNPAAFDFLLQRVEKTMRHAIEE
EENVPIEQVTNFQEVCDEIKNKLTSLKDVPNRIECPLIYHLDVGAMYPNIILTNRLQPSA
IVNEATCAACDFNKPGANCQRKMTWQWRGEFMPASRSEYHRIQQQLESEKFPPLFPDKPA
RAFHELSREEQAKYEKKRLADYCRKAYKKIHITKVEERLTTICQRENSFYVDTVRAFRDR
RYEFKGLHKVWKKKLSAAMEMGDAAEVKRCKNMEILYDSLQLAHKCILNSFYGYVMRKGA
RWYSMEMAGIVCFTGANIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVIKSTNAK
KPKVTISYPGAMLNIMVKEGFTNDQYQELTEPTSLTYITRSENSIFFEVDGPYLAMILPA
SKEEGKKLKKRYAVFNEDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGNTLEEVYA
SVAKVADYWLDVLYSRAANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFL
GDQMVKDAGLSCRFIISRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDI
RTILDWDYYIERLGSAIQKIITIPAALQQVKNPVPRVRHPDWLHKKLMEKHDIYKQKKIS
ELFIHEGKRQVTVNQHPEGSQGHGILDMEDLIQTKPLQSAIPIATKRKRIPVESQEESQN
LELIQSWREILGQPPSLGTTREEWLVWITFHKKKWELQARQRQERRKRRRVETREGVLSS
GIIRDGPATGLGHFLRKTARSILDLPWQIVQISETNQPGLFRLWAVIGNDLHCIKLNIPR
VFYVNQRVPKEEEGPSFRKVNRVLPRSNMVYNLYEYSVPEDMYQEHINEINADLSAPDIE
GVYETQVPLLLRALIQLGCVCMVSRQLVQHLTGREAETFPLEYLEMRSLAQFSYLEPGSI
RHIYLYHHSQGNKALFGLFIPSQRKSSVFVLDTVRSNQMPNLNSMYSAEHHLLLEKVGPE
LLPPDKHIFEVRAETDLKTIYRAIQRLLLGYKEERRGPTLIAVQSNWELKRLATGMPVFE
EFPLVPVCVTDDISYGALDWQRHAARRMIRHYLNLDTCLSQAFEMSRYFHIPVGNLPEDI
STFGSDLFFSRHLRHHNHLLWFSPTSRPDLGGKEADDNRLVMEFDDQASVEINSPGCYST
VCLELDIQNLAVNTILQSHHVNDMEGASSMGISFDVIQQASLEEMVTGNQAANIPASYDE
TALCSNTFRILKSMVVGWVKEITQYHNVYADNQVMHFYRWLRSPSSLLYDPALHRTLLSM
MKKLFLQLVAEFKRLGSSVIYANFNRIILCTKKRHIEDAIAYIDYITNSIHSKEIFHSLT
ISFSRCWEFLLWMDPANYGGIKGKVPTRVHYGMQNTQKEQKAEEEQESEEEQEEEEEEEK
EIIEESNVEDLLDNNWNIVQFLPQAASCQSYFLMIISAYIVAVYHSMKEELRRNAPGCTP
IKRRGNSQLSQEAEGMAGALPGMITFSQDYVANELTQNFFTITQKIQKKVMGSRNSTEPS
EMFPLLPGSHLLLNNPALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQF
RDPCRSYVLPEVICRNCNFCRDLDLCKDPFLSQDASILPQWLCSNCQAAYDSAHIEMALV
EALQKKLMAFTLQDLICLKCKGVKEANMPVYCSCAGDFSLTIQTKVFVEQIGIFRNIARH
YSMTYLTEMIDWLLQMNPQLTS
Download sequence
Identical sequences F7CEM7
ENSMODP00000018959 ENSMODP00000018959 XP_007489637.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]