SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019109 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019109
Domain Number - Region: 179-203
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00122
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 14-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0314
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019109   Gene: ENSMODG00000015304   Transcript: ENSMODT00000019454
Sequence length 354
Comment pep:known_by_projection chromosome:BROADO5:X:33132078:33233381:-1 gene:ENSMODG00000015304 transcript:ENSMODT00000019454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAVNMSLVRDTKWLTLEVCREFQRGTCSRSDAECKFAHPSRSCHVENGRVIACFDSLKG
RCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQFMLPGAQLQPITTFPVT
PSLATSPTMAFSPYLSHVSPGMGLVPAELLPNAPVLMSGNPPVTVPGGTAGQKLMRTDKL
EVCREFQRGNCTRGENDCRYAHPVDIAMIDANENTVTVCMDYIKGRCSREKCKYFHPPAH
LQAKIKAAQHQANQTAAAAMALPPGALQPLPKRPALEKNNGATTVFNPSVFHYQQALANM
QLQQPTFIPTGSVLCMAPTASVVPMMHGATPTTVSAATTPATSVPFAATATANQ
Download sequence
Identical sequences F6QDD3
ENSMODP00000019109 ENSMODP00000019109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]