SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019229 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019229
Domain Number 1 Region: 432-505
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000243
Family RING finger domain, C3HC4 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019229   Gene: ENSMODG00000015400   Transcript: ENSMODT00000019576
Sequence length 511
Comment pep:known_by_projection chromosome:BROADO5:3:504950579:505037763:1 gene:ENSMODG00000015400 transcript:ENSMODT00000019576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLEAKKTQKKHDLCLQVSKDQSGKDGFALFCLAPGTMSGSCRLVYLAFLVRESFLPMG
AVQKQKELPLEAVLRKMQRRHSSNTDSAPPERNRNQTLSSETSVDESGVFEGLKLEDSSP
PPIFSGLAGLQSGTLTATPFQSGLVLGSAPGGGEVFIQMPAPREEGASRGDGGPFHHRPA
SHHFHHGHHRGSSLLHVAGDRHGHGEEGGEDQPGTPAPALSELKAVICWLQKGLPFILIL
LAKLCFQHKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVIFWILAFLVGNTLYVLY
TFSSQQLYNSLIFLKPNLDSLDFFDLLWIVGIADFMLKYITIALKCLIVALPKIILAVKS
KGKFYLVIEELSQLFRSLVPIQLWYKYIMGDDPSNSYFLGGILIILYSLCKSFDICGRLG
GVRKALKLFCTPQNYGARATSQQCAEAGEICAICQAEFREPLVLMCQHVFCEECLCLWFD
RERTCPLCRSVAVETLRCWKDGTTSAHFQVY
Download sequence
Identical sequences F6T4Z5
XP_007490365.1.35504 XP_007490366.1.35504 XP_007490367.1.35504 XP_007490368.1.35504 XP_007490369.1.35504 ENSMODP00000019229 ENSMODP00000019229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]