SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019244 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019244
Domain Number 1 Region: 159-265
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000106
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019244   Gene: ENSMODG00000015416   Transcript: ENSMODT00000019591
Sequence length 666
Comment pep:known_by_projection chromosome:BROADO5:X:31734323:32129100:-1 gene:ENSMODG00000015416 transcript:ENSMODT00000019591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEEETEAVQGEGVTSQGHIASFKGLNQLPFDPSISHEPLQFCSPADSPLLSEGQVENED
EASKKRKRTNESTADGSRSLSMESAPMALPMSDPNAWATAMNNLRMAPLGIAGQPMLPDF
DPALGMMTGIPPITPIMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRER
PPGCKTVFVGGLPENGTEQIIVEVFEQCGDIIAIRKSKKNFCHIRFAEEFMVDKALYLSG
YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERFRPPSPPP
VVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANNFYSMIQSANSHIRRL
VNEKAAHEKGMEEAKEKFKQALAGILVQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWC
KQAEEIRNIHNDELMGIRREEEMEMSDEEIEDPNDPKENDDSALVSQTEALKEENDSLRW
QVDAYRNEVELLKQEQGKMSRDEDVTKEQQLKLLQQALQGMQQHLLKLQDEYQRKETELD
KVKDEKMQLEKLLENLQEQECRVSRICVSNQENDPLERTPTCTPVKSEREALLVGIISTF
LHVHPFGASIEYICSYLQRLDTKICTSEVETLMSRLQCTFKQEMTGVGASLEKRWKFCGF
DGLKMT
Download sequence
Identical sequences F6T3F6
ENSMODP00000019244 XP_007507234.1.35504 ENSMODP00000019244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]