SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019256 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019256
Domain Number 1 Region: 57-223
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.51e-31
Family Canonical RBD 0.0052
Further Details:      
 
Domain Number 2 Region: 229-310
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-16
Family Canonical RBD 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019256   Gene: ENSMODG00000015426   Transcript: ENSMODT00000019603
Sequence length 315
Comment pep:novel chromosome:BROADO5:X:8533359:8534316:1 gene:ENSMODG00000015426 transcript:ENSMODT00000019603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQCVGKVPEGIAGAPNESTLLALMKCRGYSMMIQENGQCKYGGPPPGWEGLHPILTPPHG
CEVFVGKIPRDVYEDELVPVFESVGRIYQMRLMMDFDGKNRGYAFIMYTHKREAKRAVRE
LDNHEIRPGRPLGVCCSVDNCRLFIGGIPKMKKRDEILEEISKVTEGVLDVIMYASAADK
TKNRGFAFIEYKSHQAAAMARRKLMPGRIQLWGQQITVDWAEPEIDVDEDVMETVKILYV
RNLMIKTSEETIRKSFVQFGFKKIRNYAFVHFTSWKGAVRAMNSLNGTELEGSCLEVTLA
KPVDKEQYTRSSEGS
Download sequence
Identical sequences F6SMM4
ENSMODP00000019256 ENSMODP00000019256 13616.ENSMODP00000019256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]