SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019299 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019299
Domain Number 1 Region: 4573-4762
Classification Level Classification E-value
Superfamily UBC-like 2.28e-39
Family UBC-related 0.0012
Further Details:      
 
Domain Number 2 Region: 282-379
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.19e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019299
Domain Number - Region: 383-426,713-749,821-871,903-968
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000915
Family WD40-repeat 0.045
Further Details:      
 
Domain Number - Region: 3224-3314
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0321
Family Galactose-binding domain 0.076
Further Details:      
 
Domain Number - Region: 69-130,389-418
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0586
Family WD40-repeat 0.045
Further Details:      
 
Domain Number - Region: 2333-2390
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0824
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019299   Gene: ENSMODG00000015462   Transcript: ENSMODT00000019647
Sequence length 4872
Comment pep:known_by_projection chromosome:BROADO5:1:515813727:516099905:1 gene:ENSMODG00000015462 transcript:ENSMODT00000019647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTGGGAAPPGTVTEPLPSVIVLSAGRKMAAAAASGPGSSSSAAAAAGAGAGVSEWLVLR
DGCMRCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGRVKCQY
ISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACIE
KVDVSSSEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSVASAIVNEL
KKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPHV
GYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVK
GEHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPHFLAAATKRGKICIWDVSKLMK
VHLKFEINAYDPAIVQQLVLLGEPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLED
SDSEEHSRSESVTGHTSQKEALEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELG
ANPCVANCKSEKTKEKHLEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGVSRTQG
ENISEQGSTDNESCNNSELNSPLVRRTLPILLLYSIKESDEKAGKIFSQMNNIMSKSLHD
DGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAANLTSPDSDKWNSMFPKPGTLVQC
LRLPKFAEEENLCVDSITPCADGVHLLVGLRTCPVESLSAINQVEALNNLNKLNSALCNR
RKGELESNLTVVNGTNISVIQHESPADVQTPLIIQPEQRSVSGGYLVLYKMNYATRIVTL
EEEPIKIQHIKDPQDTITSLILLPPDILDNREDDCEEPVEEMQLTSKNGNEREKKSDIST
LGHLVITTQGGYVKIIDLSNFEILAKVEPPKKEGTEEQDMFVSVIYCSGTDRLCACTKGG
ELHFLQIGGTCDDIDEADILVDGSLSKGVDQSLEGTKPLSNPSSPGISGVDLLVDQPFSL
ETMTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKL
QSDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKVNALN
IEVEQNGKPSLLELNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAG
MLTLTSPKLVKGMAGGKYRSFLIHVKSVNDRGTEEICNGSIRPVVRIPSLKPQSNKGHSL
ASLLAKVAAGKEKSSTTKTETSGSSRKSENLRGCDLLQEVSVTIRRFKKTSISKERVQRC
AMLQFSEFHEKLLNTLCRKSDDSLTTEHAQSLVLDTLCWLAGVHSNGPGSSKEGNESLLS
KTRKCLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPSQPGFGSVLLKALLDNMPLL
PAAATGGSVYWYFVLLNYVKDEDLAGCSTACASLLTAVSKQLQERLTPMEALLQTRYGLY
SSPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTG
LLEVEPLHFSCVSTSDGTRIERDDASTFTVSSFGVTPAVGGLSSGTVGEASTALSSAAQV
ALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAVGPVHNS
VPSNPVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDP
PTVNLAAHNKSANKSRTTPLGTGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDF
GRPVLLTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRF
MKITVIGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLRGESESSNQPEIDQHLA
MMIALQEDIQCRYNLACHRLETLLQSIDLPPLNSANNAQYFLRKPDKAVEEDTRVFSAYQ
DCIQLQLQLNLAHHAVQRLKVALGASRKTLRELPEAKDLIQMSSTEQLRTIIRYLLDTLL
SLLHSSNGHSVPAVLQNTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQF
LSNVLQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPHLPM
HRHTEGVLDIPMISWVVMLVSRLLDYVATIEDEAATAKKPLNGKERERFLTGHQWSFINN
SLHTQSLNRSSKGNSSLDRLYSRKIRKQLVHHKQQLNLLKSKQKALVEQMEKEKIQSNKG
SSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWPRSTLDAEVSTTKESPEIEPLPFTLAHE
RCISVVQKLLLFLLSMDFTCHADLLLFICKVLARIANATRPTIHLCEIVNEPQLERLLLL
MVGTDFNRGDISWGGAWAQYSLSCMLQDILAGELLAPIAAEAMEEGAVGEDVGTTTVDSD
DSLQQSSVQLLETIDEPLTHDITGAPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKD
PLAAKVFKPISSTWYDYWGADYGTYNYNPYIGGLGIPVAKPPATTEKNGSQTVSVSVSQA
LDARLEVGLEQQAELMLKMMSTLEADSILQALTNTSPTFSQSPTGTDDSLLRGFQAANQT
NQLIIQLSSIPMLSSCFNKLFSMLQVHHVQLESLLQLWLTLSLNSNSSGSKEHGADIFLY
NANRTPVISLNQASITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGPSNAIGAQE
STAHLLVSDPNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQ
IFSEFLLKLVHILSTERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSIISAVIESITFL
VHHYITCSDKVVSRSGSDSSVGARACFGGLFANIIRPGDAKAVCGEMTRDQLMFDLLKLV
NILVQLPLSSNREYSARAPVATSTTDSVSDEEKVSGGKDGNGSSSSTQGSTAYVADLVLA
NQQIMSQILSALGQCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKK
ATTVQVMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILRVLDTSEALKAFHDMGGVQL
ICNNMVTSTRAIVNTARSMVSTIMKFLDSGPSKAADSSLKARVLASEPDNAEGIHNFAPL
GTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPAAVLIKEIHIQ
PHLASLATCPSSVSVEVSADGVNMLPLSSPVVTSGLTYIKIQLVKPEVASAVCLRLHRPR
DASTLGLSQIKLLGLTAFGNTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEG
MMASAAAPTANLLQTCAALLMSPYCGMHSPNIEAVLVKIGLQSTKIGLKLIDILLRNCAA
SGSDPTDLNSPLLFGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSARVAAM
KRSGRMSYVCPSTSTREYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLNRELFESLF
NWSMSLPCNMVLKKAVDSLLCSMCHIHPNYFSLLMAWMGITPPPLQCHHRLSMTDDSKKQ
DLSSSLTDDSKNAQAPLALTESHLATLAASSQSPEAIKQLLDSGLPSLLVRSLASFCLNH
ISSSDCTSPSVDITQDKLRRHHVPQHFNKMPITADLVAPVLRFLTEVGSSHIMKDWLGGS
EVNPLWTALLFLLCHSGATSGGHSSGVPQTSARSALLSSASGTGLTTQQRTAIENATVAF
FLQCISCHPNNQRLMAQVLCELFQSSPQRGNLPTSGNISGFIRRLFLQLMLEDEKVTMFL
QSPCPLYKGRINATSHVIQHPMYGAGHKFRTLHLPISTTLAEVLDRVSDTPSITAKLINE
QKDDKEKKNHEEKEKVKAENGFQDNYSVVVASGLKSQSKRAVSSTPPRPPSRRGRTIPDK
VGSSSSGAESTSKTITVPVFHLYHKHLPGQPLPAEMTLAQLLTLLYDRKLPQGYRSIDLT
VKLGSKVISDPSLSKTDSFKRLHTEKDHVDLLGSCPEDEIITPNDECMEAVLDESFLETC
PIQSPLQVFAGMGGLALIAERLPMLYPDVIQQVSAPVVTSTTQEKPKDSDQFEWVTIEQS
GELVYEAPETIAAEPPPIKSTVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCLL
RLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRSLFSSTPLTTDDGVLLRRMALEIGAVH
LILACLSALSHHAPRVPNSNLNQSEPPVSSTHNNASTEEQQLYWAKGTGFGTGSTASGWD
VEQALTKQRLEEEHVTCLLQVLASYINPAGSSTNGDPQSTSESRGQNSNALPSVLLELLS
QSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCTSMVPLLLPLSAENGEEEEE
QSESQASVGTLLAKMKTCVDTYTNRLRSKKDKAKTGVKPDASDQEPEGLTLLVPDIQKTA
EIVYAATTSLRQANQEKKLAEYSKKAAVKPKPLSVLRSLEEKYVAVMKKLQFDTFEMVSE
DDDGKLGFKVNYHYMSQVKNASDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEER
LDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKV
CLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSSR
EYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKR
VGRTMSHHAAALKRHTAQLREELLKLPCPDGLDPEADDSSAMCSAAAGSEEAALHDQVTP
SSSKELHSDFQL
Download sequence
Identical sequences F6S3J4
ENSMODP00000019299 XP_001371603.3.35504 ENSMODP00000019299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]