SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019403 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019403
Domain Number 1 Region: 4-44
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000518
Family Variant RING domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019403   Gene: ENSMODG00000015546   Transcript: ENSMODT00000019751
Sequence length 226
Comment pep:known_by_projection chromosome:BROADO5:7:176899871:176937908:1 gene:ENSMODG00000015546 transcript:ENSMODT00000019751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYYKYHVIAISTKNPLQWQAIS
LTVIEKVQIAAAILGSLFLIASISWLIWSTFSPSAKWQRQDLLFQICYGMYGFMDVVCIG
LIIHEGPSVYRIFKRWQAVNQQWKVLNYDKTKDIEDQKAGGRTNPRTSSSTQATPPPQKR
RLHPSGPLADHHCAYTILHILSHLRPHEQRSPTGGNRELVMRVTTV
Download sequence
Identical sequences F6SKL1
ENSMODP00000019403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]