SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019498 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019498
Domain Number 1 Region: 408-860
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.29e-129
Family PIWI domain 0.003
Further Details:      
 
Domain Number 2 Region: 112-434
Classification Level Classification E-value
Superfamily PAZ domain 3.66e-87
Family PAZ domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019498   Gene: ENSMODG00000015619   Transcript: ENSMODT00000019847
Sequence length 860
Comment pep:known_by_projection chromosome:BROADO5:3:469925728:469969617:-1 gene:ENSMODG00000015619 transcript:ENSMODT00000019847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRARARARGRARGQETSQLVGPVASQQPGYLKPRPQQPTSEGELVGRGRQRGALGATK
SQELQISAGFQELSLGERGGRRRDFHDLGVNTRQNLEHVKESKTGSSGIVVRLSTNHFRL
TSRPQWALYQYHVDYNPQMEARRLRSALLFQHEELIGRCHAFDGTILFLPKRLQNKVTEV
FSQTRNGETVKITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPINI
PNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFSLYQQFGEHRFQEQVSK
ELIGLIVLTKYNNKTYRVDDIDWEQNPRSTFKKADGSEISFLDYYRKQYNTEITDLKQPV
LVSQPKRRRGPGGVLPGPALLMPELCFLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREV
GRLIDYIHKDDNVQKELRDWGLSFDSNLLSFSGRILQAEKIHQGGKTFDYNPQFADWSKE
TRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVDDRTEAY
LRVLQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVIARTLGKQQTVMAIA
TKIALQMNCKMGGELWRVDMPLKLAMIIGIDCYHDTTAGRRSIAGFVASINEGMTRWFSR
CVFQDRGQELVDGLKVCLQAALRAWNSYNEYMPSRIVVYRDGVGDGQLKTLVNYEVPQFL
DCLKSVGKGYNPRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVS
QAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFL
VGQSIHKEPNLSLSNRLYYL
Download sequence
Identical sequences F6YFN1
ENSMODP00000019498 ENSMODP00000019498 XP_001366598.1.35504 XP_007489689.1.35504 XP_012397786.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]