SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019547 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019547
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily PX domain 8.9e-21
Family PX domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019547
Domain Number - Region: 112-206
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00594
Family Ubiquitin-related 0.09
Further Details:      
 
Domain Number - Region: 211-256
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0593
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019547   Gene: ENSMODG00000015661   Transcript: ENSMODT00000019896
Sequence length 470
Comment pep:known_by_projection chromosome:BROADO5:1:508687944:508693582:1 gene:ENSMODG00000015661 transcript:ENSMODT00000019896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSIPETESRSGDSGGSNYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFTLTPAEVEQRREQLEKYMQAVRQDPLLGGSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLVTILTSDQTEDVLEAVAAKLDLPDELIGYFSLFLVREQEDGAFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIEHGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFEPCVADFPEKGCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGNTSSPNRGRGEVRLELAFEYLMSKDQLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRAGGTLRRSDSQQAVKSPPLLD
SPDATRESVVKLSSKLSAVSLRGISSPSPDTNTSDVHGNYAFEGIGDEDL
Download sequence
Identical sequences F7EIH8
13616.ENSMODP00000019547 ENSMODP00000019547 XP_001371143.1.35504 ENSMODP00000019547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]