SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019748 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019748
Domain Number 1 Region: 429-647
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-56
Family DBL homology domain (DH-domain) 0.0000449
Further Details:      
 
Domain Number 2 Region: 637-786
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-18
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 798-856
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000144
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019748   Gene: ENSMODG00000015830   Transcript: ENSMODT00000020102
Sequence length 877
Comment pep:known_by_projection chromosome:BROADO5:7:247719101:247875371:-1 gene:ENSMODG00000015830 transcript:ENSMODT00000020102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGGESEVDFSNRRDIAPLWRRRSTPQPQWLARSKPRPQSYQSPTGLLITDFPVEDRAV
LPGKEPSHTGSVSSASSSPSPSPDRRMLQRSPLLWCPNRGPVTNGKAAPLDFRAVSPRLQ
DEKSPREHRTVANPSLSYPGTLPSPETPAGHPQRIPHTSIPRSPDDEQLGLSASTGASLS
ASVPSLTSHSSALPQSPPSQSAKDPERASSKPSPCPQRTLPGQKLPLQRLPSNPEKPVVI
LSTHSAAALKVGKHQIIPKGLASEIKTSKSGGPSVEPHKRLFKVRSMVDPISVPLLPASD
GEEAESDLDSPGSLRRGLRSTSYRRAVVSGFEFDNPSNSKKKNRMSQPVLKVVMEDKEKI
SSLGRIKKIMLKGQGTFDGEENAVLYQNYKEKALDIDSDEDSEPKGQKPDEKIVIHYKPL
RSTWSQLSAVKRNGLSQSISQEERKRQEAMFEVISSEHSYLLSLEILIQMFKNSKELSDT
MTKTESHHLFSNIADVCEASKKFFKELEERHQNNIFLDDISDIVEKHTTSTFDPYIKYCT
NEVYQQRTLQKLIATNPSFKEVLSRIESQEECRNLPMISFLILPMQRVTRLPLLMDTICQ
KTPRDSPKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSR
WLVKRGELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYTVNDYSLRDQLLV
ELWDNEEPNSSPLKNSSTMLYSRQSSASHLFTLTVLSNHASEKVEMLLGAETQSERARWI
TALGHSSDRESLDRTMLTQVEIIRTFTAKQPDELSLQVSDVVLVYQHVSDGWYEGERLRD
GERGWFPMECAKEITCRATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences F7FDV3
ENSMODP00000019748 ENSMODP00000019748 XP_001372597.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]