SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019759 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019759
Domain Number - Region: 180-204
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0033
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.022
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 214-238
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0706
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019759   Gene: ENSMODG00000015838   Transcript: ENSMODT00000020113
Sequence length 399
Comment pep:known_by_projection chromosome:BROADO5:7:249570827:249755342:-1 gene:ENSMODG00000015838 transcript:ENSMODT00000020113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRADTECKFAHPSKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMIPGAPLQPVPMFSV
APSLATNASAAFNPYLGPVSPGLVPADILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDR
LEVCREYQRGNCNRGENDCRFAHPADSAMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPA
HLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRP
ALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPAT
VSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Download sequence
Identical sequences F7FDP5
ENSMODP00000019759 XP_007502412.1.35504 XP_007502413.1.35504 XP_007502414.1.35504 XP_007502415.1.35504 13616.ENSMODP00000019759 ENSMODP00000019759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]