SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019816 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019816
Domain Number 1 Region: 20-146
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-16
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 2 Region: 407-508
Classification Level Classification E-value
Superfamily SH2 domain 0.00000101
Family SH2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019816   Gene: ENSMODG00000015883   Transcript: ENSMODT00000020171
Sequence length 515
Comment pep:novel chromosome:BROADO5:7:186018763:186020335:-1 gene:ENSMODG00000015883 transcript:ENSMODT00000020171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLMAPEEQHWPVPMKAIGAQNLLPMPGGVVKSGYLHKKHGTQLQLLKWPLRFVIIRCIYS
FESGTSASPQGAFSLSGYNRVMRSAGEITSNNVFPFKIVHISKKHGTWLFSASSEDERKS
WMALLRKEIGHYQENKEPSLDFSDSSSDTDSFYGSVERPIDISLSLFPTDNEDYDHDDSY
MEPDTPDSEKVEDTMIHPPAYPPPLNPTRRKPAYAEPRRSHSFSTQCPGPSISPPPKRGL
LEISPDDLKRETVSSPGPEPNLKAPSPSRRQLLCPTSGPTSPEATSPRHLNTSKSCDKLK
SIHLILQGSPLAEPPPIPASKPKLIKMGESQPARETIKRGLFVPPVTPTPPVLVPKLPMP
ELKPRMEKPLLPQLQRSQSFRSFSFEKPSLSTKIDSSCEDSDEDYEKVPLPNSVFVNTTE
SYEAERLLKATGPRGQPQDGLYCTRNSSKTGKVLVVWDEGFNKVRNYRFEKDSRIYLEGE
LLFVSIKLVEHYYTHVFPGHKSLLLQHPYGYSGPR
Download sequence
Identical sequences F7B3Z3
ENSMODP00000019816 13616.ENSMODP00000019816 ENSMODP00000019816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]