SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019828 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019828
Domain Number 1 Region: 159-262
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.03e-23
Family Canonical RBD 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019828   Gene: ENSMODG00000015891   Transcript: ENSMODT00000020183
Sequence length 306
Comment pep:known_by_projection chromosome:BROADO5:6:157713736:157724452:-1 gene:ENSMODG00000015891 transcript:ENSMODT00000020183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSGMKKKSLLGVKENNKKSSTRAPSPTKRKDRTDEKSKDRSKDKGATKESSEKDRGRD
KARKRRSASSGSSTSSRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSS
SSGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTKNVTKDHIME
IFSTYGKIKMIDMPAERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
APWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRS
SSNSSR
Download sequence
Identical sequences F7B375
XP_007499467.1.35504 XP_007499468.1.35504 ENSMODP00000019828 13616.ENSMODP00000019828 ENSMODP00000019828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]