SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019846 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019846
Domain Number 1 Region: 191-279
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000682
Family UBX domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019846   Gene: ENSMODG00000015906   Transcript: ENSMODT00000020201
Sequence length 283
Comment pep:known_by_projection chromosome:BROADO5:4:358475944:358476795:-1 gene:ENSMODG00000015906 transcript:ENSMODT00000020201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEAPLKIALSECSPALDPEAAFIWQPSPVTMHVTRPKSAKGRTRTNLNYSHSSESSSY
RKPPSPAPTAPGDGPGSQKPVSSAPKPPNQGAPDEIPELLQQVPVGSSSSLNKYRVLPSI
NRKNLEDGAVDTVAKQASTLKLSSLQELKALCREEACSGKSREGCLRAPAPPLESKPCSR
TKERNVSLVGNLEEPSDGEPRLLLAVRSPSGQRFVRHFRPTDNLQTVVAVAEQKNLTTYH
HCSIETMEVPRRSFSDLSKSLEECGIPHKSVLGILQEEREGQP
Download sequence
Identical sequences F7AFR9
ENSMODP00000019846 13616.ENSMODP00000019846 ENSMODP00000019846 XP_007491324.1.35504 XP_007491326.1.35504 XP_007491327.1.35504 XP_016277559.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]