SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019849 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019849
Domain Number 1 Region: 26-150
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-34
Family Canonical RBD 0.000000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019849   Gene: ENSMODG00000015908   Transcript: ENSMODT00000020204
Sequence length 156
Comment pep:novel chromosome:BROADO5:7:250735517:250738488:-1 gene:ENSMODG00000015908 transcript:ENSMODT00000020204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLLCALDSDSYVQLGQYRDQHFRGDKKDQEKLLQKSCTLYVGNLSFYTTEEQIYELF
GKSGDIKKIVMGLDKVKKTACGFCFVEYYCRADAENAMRYINGTRLDDRIIRTDWDAGFK
EGRQYGRGRSGGQVRDEYRKDYDAGRGGYGKMCKVG
Download sequence
Identical sequences F7AFN8
ENSMODP00000019849 ENSMODP00000019849 13616.ENSMODP00000019849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]