SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019886 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019886
Domain Number 1 Region: 417-694
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-70
Family Protein kinases, catalytic subunit 0.000000108
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 7.98e-58
Family FAT domain of focal adhesion kinase 0.00000697
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-41
Family Second domain of FERM 0.000022
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.89e-34
Family First domain of FERM 0.00039
Further Details:      
 
Domain Number 5 Region: 261-364
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-30
Family Third domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019886   Gene: ENSMODG00000015932   Transcript: ENSMODT00000020242
Sequence length 1009
Comment pep:known_by_projection chromosome:BROADO5:1:504381842:504457783:-1 gene:ENSMODG00000015932 transcript:ENSMODT00000020242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVRVGTLRRPEVPPEPVVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQEIITSILLSGRIGPNIQLTECYGLRLKHMKSDEIHWLHPQLTVGEVQEKYEC
LHVEAEWRYDLQIRYLPEDFMETLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LKEEECVRKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIKCTPVEDGQALLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRIQGEHKG
SLILCPKKDGEKRNSLPQIPTLHLGERRSHFSESCSIESDIYAEIPDDTLRRSGALQYGV
AREDVVLGRILGEGFFGEVYEGVYQNHKRVTFHHSTIIKDKTEAQFERRGKKEMPMLMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLEHNKNSLKVLTLILYSLQICKAMAYL
ESISCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKEIAKEQERNTRYRTPKILEPVSFQDPPPKPSRP
KYKLPPQTNLLAPKLQFQVPEGLCASSPTLTSPIEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFVRPSSREEAQQLWEAERAKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEREPGYTEFTGPPQKPPRLGAQSILPTANLDRTDDMVYSNVMDLVRAVLELKNELNQ
LPPEGYVVVVKNVGLTLRKLIGSVDDILPTLPLASRTEIEGTEKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences F6Z395
ENSMODP00000019886 ENSMODP00000019886 13616.ENSMODP00000019886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]