SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019894 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019894
Domain Number 1 Region: 61-158
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.7e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0061
Further Details:      
 
Domain Number 2 Region: 815-837
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000602
Family CCCH zinc finger 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019894   Gene: ENSMODG00000015941   Transcript: ENSMODT00000020250
Sequence length 845
Comment pep:known_by_projection chromosome:BROADO5:2:266850838:266866502:-1 gene:ENSMODG00000015941 transcript:ENSMODT00000020250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGPIDPKELLKGLDSFLGRDGEVKSAEGIAKIFSLMKEARKMVSRCTYLNILLQTRSP
DVLAKFIRVGGYKLLNNWLTYSKTTNNVPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPTEKDKKKRKEEGKGRTTPLERPLPEVKA
ETRTEEAPEKKKEKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKP
IPLKRQSSSTAPGDVAPPAEKKYKPLNTTPNTTKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTATKPSPFEGKQSTEQNTAKPSSPEPAAPAEAMDIERPGTPVPPVE
IPELMDTASLDTGVLDAKPVESPGDPSQLTRKGRKRKTVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSNDNMEEKVAWVCPRPLALPSPLVSPGGNS
QERYVQAERVKGILQELFLSKESPHEPDPESYEPVPPKLIPLDEECSLDETPYSEALETG
GPGGSPDGTGGSKLPPVLANLMGSMGAGKSPQGPGGGGINVQEILTSIMGSPNSHPSEEL
LKQPDYSDKIKQLLVPHGILGPAPMANGFPPGGPGGPSGPKGMQHFPPGPGGPMPGPHGG
PGGPGGPVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNE
PPPFRGGRGGRSGGGPPNGRGGPGGGMGGGGGHRPHDGPGHGGPHGHRPHDGPGHRGHDH
RGPPPHEHRGHDGPGHGGHRGHDPHGHGGDMSSRPVCRHFMMKGSCRYENNCAFYHPGVN
GPPLP
Download sequence
Identical sequences F6Z340
ENSMODP00000019894 ENSMODP00000019894 13616.ENSMODP00000019894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]