SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019928 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019928
Domain Number 1 Region: 283-398
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000148
Family SH2 domain 0.0023
Further Details:      
 
Domain Number 2 Region: 22-85
Classification Level Classification E-value
Superfamily PH domain-like 0.000000553
Family Phosphotyrosine-binding domain (PTB) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019928   Gene: ENSMODG00000015968   Transcript: ENSMODT00000020284
Sequence length 433
Comment pep:known_by_projection chromosome:BROADO5:4:357628744:357645875:1 gene:ENSMODG00000015968 transcript:ENSMODT00000020284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAMQKVGAGARRASDTALTPHRSKGITKFTQYVGSFTVDDLGLQEKVWRVQQQLWALKD
CPRRRAVILKFSLQGLKIYSAEGELSGLHVLLPITWALSSSLHLSYFISSGFFLFPFSSP
PSPSNPAPTNRPFDSPGVQILHLLLCRSFQLSYLLQHPEDQAQPGPGPPVEEPPKPPPSP
AGPAGLIREPFGRDQVSQNVHALVSFRRLPAPAEGLAGCSAKEMSEAEGRGATPRQSRLG
NPYCSPTLVRKKAIRSKVIRSGAYRCCTYETQLQQSAREAFPDAWERWAQGASGLACLVE
SEGSLTENIWAFTGLSRARALSLLRRDVLGAFLLWPESGPGGQWCLSVKTQCGVVPHQIF
RTNLGKFSVEHLPTEFPSLEALVEHHSGAERSLFCPLDMGRLNPCYEAQDYGPSRPPWPR
GHPKQEPRQQELG
Download sequence
Identical sequences F7FDB3
ENSMODP00000019928 ENSMODP00000019928 13616.ENSMODP00000019928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]