SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020027 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020027
Domain Number 1 Region: 78-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.14e-19
Family Ubiquitin-related 0.0022
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000101
Family Ubiquitin-related 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020027   Gene: ENSMODG00000016045   Transcript: ENSMODT00000020384
Sequence length 158
Comment pep:known_by_projection chromosome:BROADO5:2:266210634:266211208:-1 gene:ENSMODG00000016045 transcript:ENSMODT00000020384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCCIVHSENWQEPMKLTAQKEDLVKKINERIQSKTKVPVENQLLSWGSQVLKPERKLSHY
WLDTSTTIHLTLKVVEPSDEELQVFLVGTNGGKKHLLHIRRSSSVSEVKEKIMAIATLPP
KAQRVICNGKELEDGKIMSDYNIQQGCTFFLWGRCIGG
Download sequence
Identical sequences F6YUI8
ENSMODP00000020027 ENSMODP00000020027 13616.ENSMODP00000020027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]