SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020165 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020165
Domain Number 1 Region: 368-469
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-23
Family Canonical RBD 0.00038
Further Details:      
 
Domain Number 2 Region: 175-273
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.01e-19
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 3 Region: 279-368
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-16
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020165   Gene: ENSMODG00000016144   Transcript: ENSMODT00000020522
Sequence length 668
Comment pep:known_by_projection chromosome:BROADO5:4:354369793:354398219:1 gene:ENSMODG00000016144 transcript:ENSMODT00000020522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGVARAPFLVVFKEPRARSLGPPSPFFQQHNKMANQVNGNAVQLKEEEEPMDTSSVTHTE
HYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALREFNEEGALSVLQQFKESDL
SHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYG
GPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGY
AFITFCGKDAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSK
VTGLTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEW
ADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRG
AAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPP
LRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGG
RGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGARGGRGGPAQPQRGRGSRGARGNR
GGNVGGKRKADGYNQPDSKRRQTNSQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQ
DTYGQQWK
Download sequence
Identical sequences F7D7F0
ENSMODP00000020165 ENSMODP00000020165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]